PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.04G153700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB
Protein Properties Length: 567aa    MW: 61799.7 Da    PI: 5.0883
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.04G153700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.56.6e-184087148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                         +g+WT  Ed +l+++vk++G g+W+++ ++ g+ R++k+c++rw ++l
  Manes.04G153700.1.p 40 KGPWTSAEDAILIEYVKKHGEGNWNAVQKHSGLSRCGKSCRLRWANHL 87
                         79******************************************9986 PP

2Myb_DNA-binding53.94.2e-1793136146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                          +g++T+eE++l++++++++G++ W++ a++++ gRt++++k++w++
  Manes.04G153700.1.p  93 KGAFTQEEEQLIIELHAKMGNK-WARMAAHLP-GRTDNEIKNYWNT 136
                          799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4413587IPR017930Myb domain
SMARTSM007173.6E-163989IPR001005SANT/Myb domain
SuperFamilySSF466895.24E-3139134IPR009057Homeodomain-like
PfamPF002494.3E-164087IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-254194IPR009057Homeodomain-like
CDDcd001673.52E-124287No hitNo description
PROSITE profilePS5129426.87288142IPR017930Myb domain
SMARTSM007172.3E-1792140IPR001005SANT/Myb domain
PfamPF002494.5E-1693136IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-2695141IPR009057Homeodomain-like
CDDcd001671.15E-1295136No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 567 aa     Download sequence    Send to blast
MSRTTNESDD GVLSKDQTES PLAEEGSCGG SANGGVVLKK GPWTSAEDAI LIEYVKKHGE  60
GNWNAVQKHS GLSRCGKSCR LRWANHLRPN LKKGAFTQEE EQLIIELHAK MGNKWARMAA  120
HLPGRTDNEI KNYWNTRIKR RQRAGLPLYP PEVSLQALHE SQRGLNISGI NSGDKGHQDL  180
CRTNNYEIPD VIFDSLKANH GISPYVPELP DITASSMLMK GLGSSQYGSF MLPTIHRQKR  240
LRESTTLIPG YGGSVKTEFP LFDQFQGNPC DKVAQSFGLS FPFDPDPTNK NPQSFGDNQG  300
SHTFANGNFS ASKPASGLVK MELPSLQYPD IDLGSWGTSP PPLLETVDTF IQSPPMGTVE  360
CSPRNSGLLD ALLQEAKTLS SGKHHSSEKS SNSSTVTPGE LAESSALNKC KTEWEDYGDP  420
LSPLGHTATS LFSECTPMST SGSSLDETPV TETLTGCNVK SELTTRAWSP EREQETTTRL  480
NITRPDALLA SDWIEQDSSY VKDQVVMTDN IASLLGDDLS SDYKQMSAEA STSNEGWGLS  540
SCAWNNMPAV CQMSEFPSEN CYLSNL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32381415107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012068750.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012068751.10.0PREDICTED: transcription factor GAMYB-like
RefseqXP_012068752.10.0PREDICTED: transcription factor GAMYB-like
TrEMBLA0A067L7W60.0A0A067L7W6_JATCU; MYB family protein
STRINGPOPTR_0003s18900.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20473485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.31e-139myb domain protein 33